PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.310T2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 301aa    MW: 33738 Da    PI: 7.0304
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.310T2genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.61e-5271311128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeelv +yL++k++++++ +  +i+e+d+yk++PwdLp +++ +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ +   +
  Araip.310T2   7 LPPGFRFHPTDEELVLHYLCRKCTSQPIAV-PIIAEIDLYKYDPWDLPGMASYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGQ--PK 101
                  79**************************99.88***************8777899*************************************98..78 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   vg+kk Lvfy+g+apkg kt+W+mheyrl
  Araip.310T2 102 PVGIKKALVFYSGKAPKGDKTNWIMHEYRL 131
                  9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-624157IPR003441NAC domain
PROSITE profilePS5100561.0437157IPR003441NAC domain
PfamPF023651.8E-278131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MASELQLPPG FRFHPTDEEL VLHYLCRKCT SQPIAVPIIA EIDLYKYDPW DLPGMASYGE  60
KEWYFFSPRD RKYPNGSRPN RAAGTGYWKA TGADKPIGQP KPVGIKKALV FYSGKAPKGD  120
KTNWIMHEYR LADVDRSVRK KNSLRLDDWV LCRIYNKKGS IEKQQPSSGV STVVNQKAES  180
SEVEDKKPDI VPRGGGGGVL PPHPPTAQAS AGGVTTDYMY FDNSDSVPKL HTDSSCSEQV  240
VSPEFASEVQ SEPKWNEWDK NLESAYNYLD ATLTNGFGFP FQGNNQMSPL QDMFMNLPKP  300
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-80316311174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6698630.0EU669863.1 Arachis hypogaea cultivar Luhua 14 NAC-like transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016163504.10.0PREDICTED: NAC domain-containing protein 2
SwissprotQ390131e-147NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB2ZHY30.0B2ZHY3_ARAHY; NAC-like transcription factor
STRINGGLYMA04G42800.11e-179(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-146NAC family protein